Protein Info for NIAGMN_03860 in Escherichia coli ECRC102

Name: ybjD
Annotation: Uncharacterized protein YbjD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 552 transmembrane" amino acids 261 to 278 (18 residues), see Phobius details amino acids 301 to 315 (15 residues), see Phobius details PF11398: DUF2813" amino acids 1 to 375 (375 residues), 533.4 bits, see alignment E=9.7e-164 PF13175: AAA_15" amino acids 1 to 50 (50 residues), 36.7 bits, see alignment 1e-12 PF20469: OLD-like_TOPRIM" amino acids 376 to 440 (65 residues), 59.2 bits, see alignment E=1.2e-19

Best Hits

Swiss-Prot: 100% identical to YBJD_ECOLI: Uncharacterized protein YbjD (ybjD) from Escherichia coli (strain K12)

KEGG orthology group: K07459, putative ATP-dependent endonuclease of the OLD family (inferred from 100% identity to eco:b0876)

Predicted SEED Role

"Predicted ATP-dependent endonuclease of the OLD family, YbjD subgroup"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (552 amino acids)

>NIAGMN_03860 Uncharacterized protein YbjD (Escherichia coli ECRC102)
MILERVEIVGFRGINRLSLMLEQNNVLIGENAWGKSSLLDALTLLLSPESDLYHFERDDF
WFPPGDINGREHHLHIILTFRESLPGRHRVRRYRPLEACWTPCTDGYHRIFYRLEGESAE
DGSVMTLRSFLDKDGHPIDVEDINDQAHHLVRLMPVLRLRDARFMRRIRNGTVPNVPNVE
VTARQLDFLARELSSHPQNLSDGQIRQGLSAMVQLLEHYFSEQGAGQARYRLMRRRASNE
QRSWRYLDIINRMIDRPGGRSYRVILLGLFATLLQAKGTLRLDKDARPLLLIEDPETRLH
PIMLSVAWHLLNLLPLQRIATTNSGELLSLTPVEHVCRLVRESSRVAAWRLGPSGLSTED
SRRISFHIRFNRPSSLFARCWLLVEGETETWVINELARQCGHHFDAEGIKVIEFAQSGLK
PLVKFARRMGIEWHVLVDGDEAGKKYAATVRSLLNNDREAEREHLTALPALDMEHFMYRQ
GFSDVFHRVAQIPENVPMNLRKIISKAIHRSSKPDLAIEVAMEAGRRGVDSVPTLLKKMF
SRVLWLARGRAD