Protein Info for NIAGMN_03705 in Escherichia coli ECRC102

Name: ureE
Annotation: urease accessory protein UreE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 154 PF02814: UreE_N" amino acids 10 to 61 (52 residues), 51.5 bits, see alignment E=5.7e-18 PF05194: UreE_C" amino acids 72 to 154 (83 residues), 104.3 bits, see alignment E=3.4e-34

Best Hits

Swiss-Prot: 100% identical to UREE_ECO5E: Urease accessory protein UreE (ureE) from Escherichia coli O157:H7 (strain EC4115 / EHEC)

KEGG orthology group: K03187, urease accessory protein (inferred from 99% identity to eoh:ECO103_3800)

Predicted SEED Role

"Urease accessory protein UreE" in subsystem Urea decomposition

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (154 amino acids)

>NIAGMN_03705 urease accessory protein UreE (Escherichia coli ECRC102)
MLYLTRRVETPAQTTASVTLPVDMRVKSRIKVTLNDGRQAGLLLPRGLLLRDGDILSNEN
GDEFIKVIAADEAVSVVRCADPFMLAKACWHLGNRHVPLQIMPGELRYHHDHVLDDMLRQ
FGLDVDFAHLPFEPEAGAYASKSHAHNHDQEHSH