Protein Info for NIAGMN_03445 in Escherichia coli ECRC102

Annotation: helicase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 722 PF13604: AAA_30" amino acids 7 to 69 (63 residues), 27.9 bits, see alignment E=6.7e-10 PF13086: AAA_11" amino acids 7 to 347 (341 residues), 75.4 bits, see alignment E=2.3e-24 PF13245: AAA_19" amino acids 11 to 81 (71 residues), 30.7 bits, see alignment E=1.1e-10 PF09848: SLFN-g3_helicase" amino acids 22 to 84 (63 residues), 29.4 bits, see alignment E=1.8e-10 PF13087: AAA_12" amino acids 454 to 536 (83 residues), 52.6 bits, see alignment E=1.6e-17 PF10881: DUF2726" amino acids 648 to 708 (61 residues), 46.6 bits, see alignment 9.5e-16

Best Hits

KEGG orthology group: None (inferred from 100% identity to eoi:ECO111_1282)

Predicted SEED Role

"DNA helicase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (722 amino acids)

>NIAGMN_03445 helicase (Escherichia coli ECRC102)
LIFPFGLNESQLLAVERAFSSQISVIEGPPGTGKTQTILNIVANILIQNKTVAILSNNNS
AVSNVYEKMDKQQLGYVMARLGSTENRQQFFSTSISRSEEVLPDSPSANAIDDVLQQVKK
HLNAINQVASLKAEINELNIEYKYLQQWQSQNLRPEELFSHKYRFSSQKTTDLMAYIHYL
SDRRIGFRNRIDLLLNFMILKVKPLMIPERRLALFTSLQLSYYEKNIREKQISLNEYEEA
FKKSDFKILLGRLTSWSMLYLKQHLRRNVSTRSSFSAETYRDEFDRFIKRFPIIGSSTHS
IINSIGKGALLDYVIIDEASQQDIVPGILGLGCARNVIVVGDRKQLPHVPVLLPNSPSPP
AEYYNCEKYSLLDSVCMLFRNMVPVTLLKEHYRCHPKIIQFCNKQFYDNALIPLTVDSGE
ASLSLVITAKGNHTRNFSNLRELESLEGHYWDEESSRGYIAPYNAQVNLAEKVLPADFVK
STVHKFQGRECDEIVFSTVLDKKRSSQHSRNIAFVDNPELVNVAVSRARNKFTLVTGNDV
FERHAGHIAALIRYIKYYADDGEIFESPVISAFDLLYSEYDKSLERLNSRLNSNDSHFKS
EQIVACLLRDILSQDSYRSMMFHSQIALNQLVLLERGDFTHREQLFMRNRASCDFVVYYK
VGKTPLGVIEVDGGYHLTSVQAERDELKNSILKKCGLPLLRLRTIDSDIEGKLGAFLSGL
TG