Protein Info for NIAGMN_03050 in Escherichia coli ECRC102

Name: elfD
Annotation: putative fimbrial chaperone protein ElfD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 233 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF00345: PapD_N" amino acids 31 to 148 (118 residues), 123.3 bits, see alignment E=6.3e-40 PF02753: PapD_C" amino acids 170 to 226 (57 residues), 53.8 bits, see alignment E=1.9e-18

Best Hits

Swiss-Prot: 100% identical to ELFD_ECO57: Probable fimbrial chaperone protein ElfD (elfD) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 98% identity to eco:b0939)

Predicted SEED Role

"Putative chaperone"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (233 amino acids)

>NIAGMN_03050 putative fimbrial chaperone protein ElfD (Escherichia coli ECRC102)
MKTCITKGIVTVSLTAILLSCSSTWAAGKGGVGLAATRLVYSEGEEQISLGVRNTSPDVP
YLIQSWVMTPDNKKSADFIITPPLFVLNPANENLLRIMYIGAPLAKDRETLFFTSVRAVP
STTKREEGNTLKIATQSVIKLFWRPKGLAYPLGEAPAKLRCTSSADMVTVSNPTPYFITL
TDLKIGGKLVKNQMISPFDKYQFSLPKGAKNSSVTYRTINDYGAETPQLNCKS