Protein Info for NIAGMN_02260 in Escherichia coli ECRC102

Name: tcyJ
Annotation: cystine ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 285 transmembrane" amino acids 29 to 48 (20 residues), see Phobius details PF00497: SBP_bac_3" amino acids 62 to 280 (219 residues), 246.3 bits, see alignment E=2.6e-77 PF10613: Lig_chan-Glu_bd" amino acids 82 to 154 (73 residues), 41.9 bits, see alignment E=9.9e-15

Best Hits

Swiss-Prot: 100% identical to FLIY_ECOL6: L-cystine-binding protein FliY (fliY) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K02424, cystine transport system substrate-binding protein (inferred from 99% identity to sfl:SF1963)

MetaCyc: 100% identical to cystine ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-290 [EC: 7.4.2.12]; 7.4.2.12 [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]

Predicted SEED Role

"Cystine ABC transporter, periplasmic cystine-binding protein FliY"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (285 amino acids)

>NIAGMN_02260 cystine ABC transporter substrate-binding protein (Escherichia coli ECRC102)
VFTNNGSTLQTDITTFGVNMKLAHLGRQALMGVMAVALIAGMSVKSFADEGLLNKVKERG
TLLVGLEGTYPPFSFQGDDGKLTGFEVEFAQQLAKHLGVEASLKPTKWDGMLASLDSKRI
DVVINQVTISDERKKKYDFSTPYTISGIQALVKKGNEGTIKTADDLKGKKVGVGLGTNYE
EWLRQNVQGVDVRTYDDDPTKYQDLRVGRIDAILVDRLAALDLVKKTNDTLAVTGEAFSR
QESGVALRKGNEDLLKAVNDAIAEMQKDGTLQALSEKWFGADVTK