Protein Info for NIAGMN_01900 in Escherichia coli ECRC102

Name: cheZ
Annotation: protein phosphatase CheZ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 214 PF04344: CheZ" amino acids 17 to 214 (198 residues), 261 bits, see alignment E=4.4e-82

Best Hits

Swiss-Prot: 100% identical to CHEZ_ECO5T: Protein phosphatase CheZ (cheZ) from Escherichia coli O157:H7 (strain TW14359 / EHEC)

KEGG orthology group: K03414, chemotaxis protein CheZ (inferred from 100% identity to eco:b1881)

Predicted SEED Role

"Chemotaxis response - phosphatase CheZ" in subsystem Bacterial Chemotaxis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (214 amino acids)

>NIAGMN_01900 protein phosphatase CheZ (Escherichia coli ECRC102)
MMQPSIKPADEHSAGDIIARIGSLTRMLRDSLRELGLDQAIAEAAEAIPDARDRLYYVVQ
MTAQAAERALNSVEASQPHQDQMEKSAKALTQRWDDWFADPIDLADARELVTDTRKFLAD
VPAHTSFTNAQLLEIMMAQDFQDLTGQVIKRMMDVIQEIERQLLMVLLENIPEQESRPKR
ENQSLLNGPQVDTSKAGVVASQDQVDDLLDSLGF