Protein Info for NIAGMN_01865 in Escherichia coli ECRC102

Name: cutC
Annotation: copper homeostasis protein CutC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 PF03932: CutC" amino acids 3 to 200 (198 residues), 304.4 bits, see alignment E=1.6e-95

Best Hits

Swiss-Prot: 100% identical to CUTC_ECO57: Copper homeostasis protein CutC (cutC) from Escherichia coli O157:H7

KEGG orthology group: K06201, copper homeostasis protein (inferred from 98% identity to eco:b1874)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (248 amino acids)

>NIAGMN_01865 copper homeostasis protein CutC (Escherichia coli ECRC102)
MALLEICCYSMECALTAQQNGADRVELCAAPKEGGLTPSLGVLKSVRQRVTIPVHPIIRP
RGGDFCYSDGEFAAILEDVRTVRELGFPGLVTGVLDVDGNVDMSRMEKIMASAGPLAVTF
HRAFDMCANPLNTLNNLAELGIARVLTSGQKSDALQGLSKIMELIAHRDAPIIMAGAGVR
AENLHHFLDAGVLEVHSSAGAWQASPMRYRNQGLSMSSDAHADEYSRYVVDGAAVAEMKG
IIERHQAK