Protein Info for NIAGMN_01755 in Escherichia coli ECRC102

Name: znuA
Annotation: zinc ABC transporter substrate-binding protein ZnuA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01297: ZnuA
  • amino acids 46 to 324 (279 residues), 214.3 bits, E=1.1e-67

Best Hits

Swiss-Prot: 99% identical to ZNUA_ECOLI: High-affinity zinc uptake system protein ZnuA (znuA) from Escherichia coli (strain K12)

KEGG orthology group: K09815, zinc transport system substrate-binding protein (inferred from 99% identity to sfv:SFV_1860)

MetaCyc: 99% identical to Zn2+ ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
ABC-63-RXN [EC: 7.2.2.20]

Predicted SEED Role

"Zinc ABC transporter, periplasmic-binding protein ZnuA" in subsystem Transport of Zinc

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.2.2.20

Protein Sequence (328 amino acids)

>NIAGMN_01755 zinc ABC transporter substrate-binding protein ZnuA (Escherichia coli ECRC102)
MKCYNITLLMFITMIGRIMLHKKTLLFAALFAALWGGATQAADAAVVASLKPVGFIASAI
ADGVTETEVLLPDGASEHDYSLRPSDVKRLQNADLVVWVGPEMEAFMQKPVSKLPEAKQV
TIAQLEDVKPLLMKSINGDDDDHDHAEKSDEDHHHGDFNMHLWLSPEIARATAVAIHGKL
VELMPQSRAKLDANLKDFEAQLASTETQVGNELAPLKGKGYFVFHDAYGYFEKQFGLTPL
GHFTVNPEIQPGAQRLHEIRTQLVEQKATCVFAEPQFRPAVVESVARGTSVRMGTLDPLG
TNIKLGKTSYSEFLSQLANQYASCLKGD