Protein Info for NIAGMN_01620 in Escherichia coli ECRC102

Name: rsmF
Annotation: 16S rRNA (cytosine(1407)-C(5))-methyltransferase RsmF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF17125: Methyltr_RsmF_N
  • amino acids 35 to 132 (98 residues), 94 bits, E=1.3e-30
• TIGR00446: NOL1/NOP2/sun family putative RNA methylase
  • amino acids 68 to 337 (270 residues), 384 bits, E=1.6e-119
• PF01189: Methyltr_RsmB-F
  • amino acids 145 to 336 (192 residues), 155.3 bits, E=3.4e-49
• PF21150: YebU_pre-PUA_dom
  • amino acids 356 to 432 (77 residues), 128.6 bits, E=1.3e-41
• PF13636: Methyltranf_PUA
  • amino acids 448 to 496 (49 residues), 43.2 bits, 6.6e-15

Best Hits

Swiss-Prot: 100% identical to RSMF_ECO5E: Ribosomal RNA small subunit methyltransferase F (rsmF) from Escherichia coli O157:H7 (strain EC4115 / EHEC)

KEGG orthology group: K11392, ribosomal RNA small subunit methyltransferase F [EC: 2.1.1.-] (inferred from 100% identity to eok:G2583_2285)

MetaCyc: 96% identical to 16S rRNA m5C1407 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11593 [EC: 2.1.1.178]

Predicted SEED Role

"Ribosomal RNA small subunit methyltransferase F (EC 2.1.1.-)" (EC 2.1.1.-)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.178

Protein Sequence (506 amino acids)

>NIAGMN_01620 16S rRNA (cytosine(1407)-C(5))-methyltransferase RsmF (Escherichia coli ECRC102)
MPTAPACLRRSVYAKLRACFFCQWYMLVAQHTVYFPDAFLTQMREAMPSTLSFDDFLAAC
QRPLRRSIRVNTLKTSVADFLRLTAPYGWTLTPIPWCEEGFWIERDDEDALPLGSTAEHL
SGLFYIQEASSMLPVAALFADGNAPQRVMDVAAAPGSKTTQIAARMNNEGAILANEFSAS
RVKVLHANISRCGISNVALTHFDGRVFGAALPEMFDAILLDAPCSGEGVVRKDPDALKNW
SPESNQEIAATQRELIDSAFHALRSGGTLVYSTCTLNREENESVCLWLKETYPDAVEFLP
LGDLFPGANKALTEEGFLHVFPQIYDCEGFFVARLRKTQAIPALPTPKYKVGNFPFSPVK
DREAAQIRQAAASVGLNWDGNLRLWQRDKEVWLFPVGIEALIGKVRFSRLGIKLAETHNK
GYRWQHEAVIALASPDNENAFELTPQEAEEWYRGRDVYPQAAPVADDVLVTFQHQPIGLA
KRIGSRLKNSYPRELVRDGKLFTSNA