Protein Info for NIAGMN_01545 in Escherichia coli ECRC102

Annotation: UPF0266 membrane protein YobD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 152 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 45 to 62 (18 residues), see Phobius details amino acids 68 to 87 (20 residues), see Phobius details PF06173: DUF986" amino acids 4 to 150 (147 residues), 215.1 bits, see alignment E=2.3e-68

Best Hits

Swiss-Prot: 100% identical to YOBD_ECO5E: UPF0266 membrane protein YobD (yobD) from Escherichia coli O157:H7 (strain EC4115 / EHEC)

KEGG orthology group: None (inferred from 99% identity to eco:b1820)

Predicted SEED Role

"FIG00510464: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (152 amino acids)

>NIAGMN_01545 UPF0266 membrane protein YobD (Escherichia coli ECRC102)
MTITDLVLILFIAALLAFAIYDQFIMPRRNGPTLLAIPLLRRGRIDSVIFVGLIVILIYN
NVTNHGALITTWLLSALALMGFYIFWIRVPKIIFKQKGFFFANVWIEYSRIKAMNLSEDG
VLVMQLEQRRLLIRVRNIDDLERIYKLLVSTQ