Protein Info for NIAGMN_01145 in Escherichia coli ECRC102

Name: astB
Annotation: N-succinylarginine dihydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 447 PF04996: AstB" amino acids 3 to 440 (438 residues), 699.5 bits, see alignment E=8.3e-215 TIGR03241: succinylarginine dihydrolase" amino acids 3 to 440 (438 residues), 808.6 bits, see alignment E=8e-248

Best Hits

Swiss-Prot: 100% identical to ASTB_ECO57: N-succinylarginine dihydrolase (astB) from Escherichia coli O157:H7

KEGG orthology group: K01484, succinylarginine dihydrolase [EC: 3.5.3.23] (inferred from 100% identity to ecf:ECH74115_2463)

MetaCyc: 99% identical to N-succinylarginine dihydrolase (Escherichia coli K-12 substr. MG1655)
N-succinylarginine dihydrolase. [EC: 3.5.3.23]

Predicted SEED Role

"Succinylarginine dihydrolase (EC 3.5.3.23)" in subsystem Arginine and Ornithine Degradation (EC 3.5.3.23)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.3.23

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (447 amino acids)

>NIAGMN_01145 N-succinylarginine dihydrolase (Escherichia coli ECRC102)
MNAWEVNFDGLVGLTHHYAGLSFGNKASTRHRFQVSNPRLAAKQGLLKMKTLADAGFPQA
VIPPHERPFIPVLRQLGFSGSDEQVLEKVVRQAPHWLSSVSSASPMWVANAATIAPSADT
LDGKVHLTVANLNNKFHRSLEAPVTESLLKAIFNDEEKFSVHSALPQVALLGDEGAANHN
RLGGHYGEPGMQLFVYGREEGNDTRPSRYPARQTREASEAVARLNQVNPQQVIFAQQNPD
VIDQGVFHNDVIAVSNRQVLFCHQQAFARQSQLLANLRARVNGFMAIEVPATQVSVSDAV
STYLFNSQLLSRDDGSMMLVLPQECREHAGVWGYLNELLAADNPISELKVFDLRESMANG
GGPACLRLRVVLTQEERRAVNPAVMMNDTLFNALNDWVDRYYRDRLTAADLADPQLLREG
REALDVLSQLLNLGSVYPFQREGGGNG