Protein Info for NIAGMN_00350 in Escherichia coli ECRC102

Name: asr
Annotation: acid resistance repetitive basic protein Asr

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 102 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details

Best Hits

Swiss-Prot: 100% identical to ASR_ECO57: Acid shock protein (asr) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 99% identity to eco:b1597)

Predicted SEED Role

"Acid shock protein precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (102 amino acids)

>NIAGMN_00350 acid resistance repetitive basic protein Asr (Escherichia coli ECRC102)
MKKVLALVVAAAMGLSSAAFAAETATTPAPTATTTKAAPAKTTHHKKQHKAAPAQKAQAA
KKHHKNTKAEQKAPEQKAQAAKKHAKKHSHQQPAKPAAQPAA