Protein Info for NIAGMN_00290 in Escherichia coli ECRC102

Name: ynfC
Annotation: YnfC family lipoprotein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details PF06788: UPF0257" amino acids 14 to 248 (235 residues), 433 bits, see alignment E=1.7e-134

Best Hits

Swiss-Prot: 100% identical to YNFC_ECO57: UPF0257 lipoprotein YnfC (ynfC) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 100% identity to ecf:ECH74115_2294)

Predicted SEED Role

"Hypothetical UPF0257 lipoprotein ynfC precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (248 amino acids)

>NIAGMN_00290 YnfC family lipoprotein (Escherichia coli ECRC102)
MIENHLYSLVTDVKYKLLPCLLAILLTGCDRTEVTLSFTPEMASFSNEFDFDPLRGPVKD
FTQTLMDEQGEVTKRVSGTLSEEGCFDSLELLDLENNTVVALVLDANYYRDAETLEKRVR
LQGKCQLAELPSAGVSWETDDNGFVIKASSKQMQMEYRYDDQGYPLGKTTKSNDKTLSVS
ATPSTDPIKKLDYTAVTLLNNQRVGNVKQSCEYDSHANPVGCQLIIVDEGVKPAVERVYT
IKNTIDYY