Protein Info for MPMX26_03185 in Acinetobacter radioresistens SK82

Annotation: putative phosphite transport system-binding protein PtxB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 290 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details TIGR01098: phosphate/phosphite/phosphonate ABC transporter, periplasmic binding protein" amino acids 2 to 251 (250 residues), 254.1 bits, see alignment E=7.3e-80 PF12974: Phosphonate-bd" amino acids 38 to 273 (236 residues), 239.7 bits, see alignment E=1.5e-75

Best Hits

Swiss-Prot: 61% identical to PTXB_PSEST: Probable phosphite transport system-binding protein PtxB (ptxB) from Pseudomonas stutzeri

KEGG orthology group: K02044, phosphonate transport system substrate-binding protein (inferred from 80% identity to mms:mma_3041)

Predicted SEED Role

"Phosphonate ABC transporter phosphate-binding periplasmic component (TC 3.A.1.9.1)" in subsystem ABC transporter alkylphosphonate (TC 3.A.1.9.1) (TC 3.A.1.9.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (290 amino acids)

>MPMX26_03185 putative phosphite transport system-binding protein PtxB (Acinetobacter radioresistens SK82)
MKKLFEKLFAVLALISFSLLGSVTYAAPNPDPGTLKVALLPDENASTVIKNNKPLEMYLE
KALGKKIELIVTTDYSSMIEGMRFGRIDLAYFGPLSYVLAKQKSKIEPFAAMQQKGTTTY
QSVLIVNKAAGINNITDIKKKAVAWGDKASTSSHLIPKSMLADKGLFAGKDYKEHFVGAH
DAVAMAVQNGHAQAGGLSKPIFKSLVQSGLIDLNKVKVLVESKPFPQYPWTMRSNLKPEL
KVKIRAAFLDLKDPNVLKPFKADGFGPATDKDYDVVRDLGSLLKLDFSKF