Protein Info for MPMX26_03175 in Acinetobacter radioresistens SK82

Annotation: Phosphoethanolamine transferase EptA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 558 transmembrane" amino acids 20 to 38 (19 residues), see Phobius details amino acids 50 to 71 (22 residues), see Phobius details amino acids 82 to 105 (24 residues), see Phobius details amino acids 125 to 147 (23 residues), see Phobius details amino acids 166 to 187 (22 residues), see Phobius details PF08019: EptA_B_N" amino acids 64 to 213 (150 residues), 134.8 bits, see alignment E=2.4e-43 PF00884: Sulfatase" amino acids 242 to 535 (294 residues), 241.5 bits, see alignment E=1.3e-75

Best Hits

KEGG orthology group: K03760, phosphoethanolamine transferase (inferred from 68% identity to aby:ABAYE0731)

Predicted SEED Role

"Phosphoethanolamine transferase EptA specific for the 1 phosphate group of core-lipid A" in subsystem Lipid A modifications

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (558 amino acids)

>MPMX26_03175 Phosphoethanolamine transferase EptA (Acinetobacter radioresistens SK82)
MLKLPSFPGLRQIKPISLARFNLLLAIWLGLVLNFAFYQKIHQLTPYTNLKAGALLAATV
LVVIGLYNLVLQWLNWKWNAKILASVLIILGGFSAYFVNSLGVVITPDQIQNMLQTDARE
VRDLWSIRLVIWTLVFVIFPLFIVWILKIQPVSLGRQLLHKSLSSVLSLGLILSLLFCFY
VDYAAIFREHRDLKGMISPQNSIASTLSYYKKKAPKANLPLVTFGEDAHLLQQTQMQSKP
KLMVLVVGETARAESFALNGYARNTNPELSKLQVINFNQVSSCGTATAVSVPCMFSGMSR
ETYDEQLASHREGLLDIAQRAGYQVTWIDNNSGCKGACDRVQKYQIPAQLKQKWCDAGGE
CFDEILVDSLKDYLSHLDKNNQKPQLIVLHQMGSHGPAYFKRSKSPYQPFQPTCNTNAIQ
GCSADELKNSYDNSIVYTDYVLAQMIKTLQDQKQYQTGFWYLSDHGESTGEHGLYLHGAP
YSIAPTQQTHVPMLMWFSEYWQQYNTQQVNCLKAQTGKMHSQDNLFPSLLSLLGIKTQVI
EAKNDMLAQCSSSLKNRA