Protein Info for MPMX26_03096 in Acinetobacter radioresistens SK82

Annotation: Metal cation efflux system protein CzcD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 299 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 50 to 67 (18 residues), see Phobius details amino acids 87 to 106 (20 residues), see Phobius details amino acids 118 to 141 (24 residues), see Phobius details amino acids 154 to 176 (23 residues), see Phobius details amino acids 182 to 202 (21 residues), see Phobius details TIGR01297: cation diffusion facilitator family transporter" amino acids 16 to 290 (275 residues), 295.8 bits, see alignment E=1.6e-92 PF01545: Cation_efflux" amino acids 20 to 211 (192 residues), 154 bits, see alignment E=2.2e-49

Best Hits

Swiss-Prot: 60% identical to CZCD_CUPMC: Metal cation efflux system protein CzcD (czcD) from Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)

KEGG orthology group: K03295, cation efflux system protein, CDF family (inferred from 77% identity to aci:ACIAD3374)

MetaCyc: 38% identical to Zn2+/Cd2+/Ni2+/Cu2+ exporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-200

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein CzcD" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (299 amino acids)

>MPMX26_03096 Metal cation efflux system protein CzcD (Acinetobacter radioresistens SK82)
MSEHHDHSHAVVTEENSKKLMVALGLTTTFLIVEVVAAFITQSLALLSDAAHMFTDVAAL
AIALAAIKIGKKAADDKRTFGYQRFEILAALFNAVMLFVVAIYIVYEAYQRFTNPAEIQS
VEMMIVAVIGLVVNLISMKILSASAEGSLNIKGAYLEVLSDALGSIGVIIGGIVIYFTQW
MWVDTVIAVLIGFWVLPRTWILLKQSINILLEGVPDEIDIESLRNDLLKLEGVEGIHQLK
VWAISSKNIHLTAHLVAPNSNTDQLYQKALEVLKHNHNITEITLQIESKECNTLEQHKH