Protein Info for MPMX26_03073 in Acinetobacter radioresistens SK82

Annotation: Ribonuclease P protein component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00825: Ribonuclease_P
  • amino acids 6 to 113 (108 residues), 96.2 bits, E=6e-32
• TIGR00188: ribonuclease P protein component
  • amino acids 11 to 115 (105 residues), 80.8 bits, E=4.3e-27

Best Hits

Swiss-Prot: 83% identical to RNPA_ACIAD: Ribonuclease P protein component (rnpA) from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)

KEGG orthology group: K03536, ribonuclease P protein component [EC: 3.1.26.5] (inferred from 83% identity to aci:ACIAD3683)

Predicted SEED Role

"Ribonuclease P protein component (EC 3.1.26.5)" in subsystem tRNA processing (EC 3.1.26.5)

MetaCyc Pathways

• tRNA processing (10/10 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.26.5

Protein Sequence (130 amino acids)

>MPMX26_03073 Ribonuclease P protein component (Acinetobacter radioresistens SK82)
MTLYSFSTAVRIRCAADYKSVFDGALFKVHQPHFLFLARPTELHHSRLGIVVAKKKVRRA
HERNRIKRLARESFRLHQQQLELLDIVVMPKIGIEDISNAELHQQLQIAWQKLQRQVKKH
RKIAVSSSQN