Protein Info for MPMX26_03072 in Acinetobacter radioresistens SK82

Annotation: Putative membrane protein insertion efficiency factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 106 PF01809: YidD" amino acids 3 to 68 (66 residues), 107 bits, see alignment E=1.7e-35 TIGR00278: putative membrane protein insertion efficiency factor" amino acids 7 to 73 (67 residues), 93.3 bits, see alignment E=3.1e-31

Best Hits

Swiss-Prot: 87% identical to YIDD_ACIAD: Putative membrane protein insertion efficiency factor (ACIAD3682) from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)

KEGG orthology group: K08998, hypothetical protein (inferred from 87% identity to aci:ACIAD3682)

Predicted SEED Role

"Protein YidD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (106 amino acids)

>MPMX26_03072 Putative membrane protein insertion efficiency factor (Acinetobacter radioresistens SK82)
MRRLLHWLIRFYQIAISPLLGPRCRYIPTCSQYSLEAIHAHGAMRGVWLAGKRICRCHPW
GGSGYDPVPPKAIRFISFQQIDSQTFHVTVPFRDRFLNQNHSNHLG