Protein Info for MPMX26_03071 in Acinetobacter radioresistens SK82

Annotation: Membrane protein insertase YidC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 584 transmembrane" amino acids 7 to 24 (18 residues), see Phobius details amino acids 393 to 412 (20 residues), see Phobius details amino acids 457 to 479 (23 residues), see Phobius details amino acids 499 to 516 (18 residues), see Phobius details amino acids 535 to 557 (23 residues), see Phobius details TIGR03593: membrane protein insertase, YidC/Oxa1 family, N-terminal domain" amino acids 5 to 391 (387 residues), 344.7 bits, see alignment E=8.9e-107 PF14849: YidC_periplas" amino acids 83 to 380 (298 residues), 246.7 bits, see alignment E=4.7e-77 PF02096: 60KD_IMP" amino acids 385 to 575 (191 residues), 270.1 bits, see alignment E=1.1e-84 TIGR03592: membrane protein insertase, YidC/Oxa1 family" amino acids 392 to 571 (180 residues), 236.6 bits, see alignment E=2.4e-74

Best Hits

KEGG orthology group: K03217, preprotein translocase subunit YidC (inferred from 85% identity to abb:ABBFA_003528)

Predicted SEED Role

"Inner membrane protein translocase component YidC, long form"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (584 amino acids)

>MPMX26_03071 Membrane protein insertase YidC (Acinetobacter radioresistens SK82)
MQQWARFAILGAMFVVAYLLILAWQKDYGHAETAPQQQAVVSHEVSADLPNSQAASASSD
VPQANIATPQATDVTAPVNQQLISVQTDLYHLLINPKGGDIVRIELLNHDKNKDSDQPFV
MLESDAKRTYVAQSGLIGLNGPDSNRSGRPVYEVEKTSYDLLKDAQTVSKDNGKAVKVLT
IPMVYKTADGVEIIKTFTFKQGEYPIVVNHKVVNRSQQNWQGQMFGQIKRDNSEDPGKSD
QGIFTLGTFLGGAWGTPEEHYNKLKFDNFNDEKLNVDAKGGWIAVVQHYFVSAWIPGQLK
LTQANGQPYAAKLESRKSADDMNIISFTSPTINVPAGTVAEVDATFYSGPKIQSELKDLA
VGLNQTVDYGWLWPIAKLLFLGLQFFHNIVGNWGWSIILLTILVKLILWPLSSKSYRSMA
KMRVIAPEMQRMKEEFGEDRMRFSQEMMALYKREQVNPLSGCLPLLLQMPIFLALYWVLM
ESVELRHAPWFGWIQDLSAMDPWFILPLVMGLTMFTQQSLNPQPADPMQAKVFKIMPIIF
TIFMLFFPAGLVLYWIVNNSITILQQWFINRSVKKERENGVEVI