Protein Info for MPMX26_03067 in Acinetobacter radioresistens SK82

Annotation: Cadmium, cobalt and zinc/H(+)-K(+) antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 323 transmembrane" amino acids 25 to 46 (22 residues), see Phobius details amino acids 55 to 72 (18 residues), see Phobius details amino acids 93 to 112 (20 residues), see Phobius details amino acids 126 to 147 (22 residues), see Phobius details amino acids 189 to 211 (23 residues), see Phobius details amino acids 217 to 236 (20 residues), see Phobius details TIGR01297: cation diffusion facilitator family transporter" amino acids 22 to 306 (285 residues), 207.7 bits, see alignment E=1.1e-65 PF01545: Cation_efflux" amino acids 27 to 247 (221 residues), 121.8 bits, see alignment E=1.6e-39

Best Hits

KEGG orthology group: None (inferred from 77% identity to abn:AB57_0028)

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein CzcD" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (323 amino acids)

>MPMX26_03067 Cadmium, cobalt and zinc/H(+)-K(+) antiporter (Acinetobacter radioresistens SK82)
MQNFNLSRHHKHQFDQGNPLAQKRILWATLLTGFMMLLEISGGWLFNSMALLADGWHMSS
HMLALGLAYLAYRAARHYANDQRFSFGTWKIEILAGYSSAILLIVVALYMAVHSVERLIF
PVAIHYNEAIPIAVLGLLVNLLCAWLLHDHTDHHHHHHHHHHHHHHEHEHEHEHEHEHRK
HSHDLNQKAAFLHVVADAVTSVFAIIALLAGKYFGCAFLDAVLGVAGAVLVARWAWGLIR
DTGRTLLDAEMDHPVVAEIREVIVGLPVQVEITDLHVWKVGRGKFACILALETQDDLNAD
QVRDALSIHEEVVHISVEINMPL