Protein Info for MPMX26_03050 in Acinetobacter radioresistens SK82

Annotation: N5-carboxyaminoimidazole ribonucleotide synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 373 PF22660: RS_preATP-grasp-like" amino acids 3 to 96 (94 residues), 79.3 bits, see alignment E=4.6e-26 TIGR01161: phosphoribosylaminoimidazole carboxylase, ATPase subunit" amino acids 4 to 351 (348 residues), 378.6 bits, see alignment E=1.8e-117 PF02786: CPSase_L_D2" amino acids 102 to 267 (166 residues), 28.3 bits, see alignment E=2.5e-10 PF02222: ATP-grasp" amino acids 104 to 280 (177 residues), 204 bits, see alignment E=3e-64 PF17769: PurK_C" amino acids 301 to 351 (51 residues), 58.3 bits, see alignment 1e-19

Best Hits

Swiss-Prot: 47% identical to PURK_VIBCH: N5-carboxyaminoimidazole ribonucleotide synthase (purK) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K01589, 5-(carboxyamino)imidazole ribonucleotide synthase [EC: 6.3.4.18] (inferred from 85% identity to abc:ACICU_00026)

Predicted SEED Role

"Phosphoribosylaminoimidazole carboxylase ATPase subunit (EC 4.1.1.21)" in subsystem De Novo Purine Biosynthesis (EC 4.1.1.21)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.21

Use Curated BLAST to search for 4.1.1.21 or 6.3.4.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (373 amino acids)

>MPMX26_03050 N5-carboxyaminoimidazole ribonucleotide synthase (Acinetobacter radioresistens SK82)
MNKTIGIFGGGQLGRMMAQAALPLNIQCTFFEANHNCPSAILGQVFSEHDAQGLEKFIES
ADVFSLEFENTPLADVDTLLQSKQLYPPRQALATAQNRLLEKALFDQLDIPVAPYRAVDS
LSSLQQAVTELGLPIVLKTATGGYDGKGQFVLREQEQIEQAWAELGPAKSLIAESFVKFS
REVSIIAVRGQNGEVKSWPLAENHHHHGILSHSIVPAPNSEQLQPVAQDYITRLLNHLNY
VGVLTLELFVTEAGLYANEMAPRVHNSGHWSIEGAVCSQFENHIRAVAGLPLGSTEVLRP
TVMINIIGRYPDAAQILALNGVHLHMYNKEERPGRKLGHITLMPVNHAELTELCRQLAKI
LPEPLALTQDMNI