Protein Info for MPMX26_03049 in Acinetobacter radioresistens SK82

Annotation: Tn3 family transposase TnXax1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02283: lytic murein transglycosylase
  • amino acids 48 to 348 (301 residues), 360.9 bits, E=2.5e-112
• PF13406: SLT_2
  • amino acids 49 to 344 (296 residues), 360.4 bits, E=7.1e-112
• PF01471: PG_binding_1
  • amino acids 365 to 420 (56 residues), 52.8 bits, 3.7e-18

Best Hits

KEGG orthology group: None (inferred from 79% identity to aby:ABAYE3869)

Predicted SEED Role

"Membrane-bound lytic murein transglycosylase B precursor (EC 3.2.1.-)" in subsystem Peptidoglycan Biosynthesis (EC 3.2.1.-)

KEGG Metabolic Maps

• Ascorbate and aldarate metabolism
• Glycosaminoglycan degradation
• Nucleotide sugars metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.-

Use Curated BLAST to search for 3.2.1.-

Protein Sequence (427 amino acids)

>MPMX26_03049 Tn3 family transposase TnXax1 (Acinetobacter radioresistens SK82)
MRHFALIFSTAFLSVSQVNAELIINGQSSSTSVTATSAISNAYSPQNNFQACLGNLRSQA
ISAGVNGSTYDRYTQSLTPDYSVIDKLNYQPEFSTPIWDYLSGLVDEERVQAGRTKLAQH
AEVLKRVEAAYGVPAETVVAVWGVESNFGDISGSYPLLQALGTLSCEGRRQSYFRGEFFA
AMRILQRGDLREEQLKGSWAGAFGHTQFMPSTYEELAVDFDGDGRRDLVSSTIDALASTA
NFLKKRGWQTGMPWGFEVKLPSGFSAQGEGRRNKKALNSWVNRGLTRTDGTALVQGNLSG
STPAGLMMPAGENGPAFLVFKNFDAIYSYNAAESYGLAIAHLSDRLQGQGPFLTAWPTDD
AGTSRAERREIQQFLLKKGYDIGAVDGLIGDKTRQAIRQEQQRLGLNPTGRAGQQILRAL
RAEYIMQ