Protein Info for MPMX26_03033 in Acinetobacter radioresistens SK82

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 283 PF12146: Hydrolase_4" amino acids 43 to 152 (110 residues), 39 bits, see alignment E=9e-14 PF00561: Abhydrolase_1" amino acids 48 to 135 (88 residues), 39.4 bits, see alignment E=8.7e-14 PF12697: Abhydrolase_6" amino acids 51 to 238 (188 residues), 31 bits, see alignment E=6.3e-11

Best Hits

KEGG orthology group: None (inferred from 60% identity to acd:AOLE_08080)

Predicted SEED Role

"Alpha/beta hydrolase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (283 amino acids)

>MPMX26_03033 hypothetical protein (Acinetobacter radioresistens SK82)
MNNYIEVKCRDGYILKGILYPSTAPIKKSEPIIISPATGIVQQFYQPFAVWLTQQGYDVL
TFDFRGIGASLNGALKDSKASIQDWGLLDLPAVIDTALKKTGASQVNIIGHSAGGQLVGL
VENHQQVKQLISIAGSTGHIKGLKGRTKLLAPLMFNLLFPLSSAFKGYGAAKVIGMGENL
PKGVARQWAQFCSRPGYVMNAVGKTINKHYHEQVCCPITAIAATDDEIATEQNIDALLKL
YPLAPTKKLIIQPKHYGHRSIGHMLMFRPSHQNLWPLIAGQLN