Protein Info for MPMX26_03020 in Acinetobacter radioresistens SK82

Annotation: Methionyl-tRNA formyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 320 TIGR00460: methionyl-tRNA formyltransferase" amino acids 1 to 312 (312 residues), 305 bits, see alignment E=2.7e-95 PF00551: Formyl_trans_N" amino acids 1 to 185 (185 residues), 163.2 bits, see alignment E=5.9e-52 PF02911: Formyl_trans_C" amino acids 211 to 309 (99 residues), 89.5 bits, see alignment E=1.4e-29

Best Hits

Swiss-Prot: 79% identical to FMT_ACIBT: Methionyl-tRNA formyltransferase (fmt) from Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)

KEGG orthology group: K00604, methionyl-tRNA formyltransferase [EC: 2.1.2.9] (inferred from 79% identity to abc:ACICU_03655)

MetaCyc: 51% identical to 10-formyltetrahydrofolate:L-methionyl-tRNAfMet N-formyltransferase (Escherichia coli K-12 substr. MG1655)
Methionyl-tRNA formyltransferase. [EC: 2.1.2.9]; 2.1.2.9 [EC: 2.1.2.9]

Predicted SEED Role

"Methionyl-tRNA formyltransferase (EC 2.1.2.9)" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase or Folate Biosynthesis (EC 2.1.2.9)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (320 amino acids)

>MPMX26_03020 Methionyl-tRNA formyltransferase (Acinetobacter radioresistens SK82)
MRIIFAGTPEFAAVALNALLKTPHDIVAVYTQPDRKAGRGQKLTASAVKQLALAHDLPVF
QPLHFKSSTEEGLAAQQQLAALNADVMVVAAYGLILPQAVLDTPKYGCLNIHGSLLPRWR
GAAPIQRAIATGDQVTGVTIMKMAAGLDTGDMMLKTLCPILASDTSATLHDKLAVQGAEA
ICTVLESEQTLQQALADSEVQNDSLAVYAHKLSKAEAEIDWTQDAVALDRNIRAFNPWPV
AFCQLDDNIALRVWESRLSDQPDTAAQPGEIVAIDKKGVHIKCGQHTVLCLTSLQWPGGK
PLNAVQINQTQKLKVGQILQ