Protein Info for MPMX26_03016 in Acinetobacter radioresistens SK82

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 247 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 30 to 31 (2 residues), see Phobius details amino acids 33 to 57 (25 residues), see Phobius details amino acids 69 to 88 (20 residues), see Phobius details amino acids 95 to 113 (19 residues), see Phobius details amino acids 131 to 153 (23 residues), see Phobius details amino acids 164 to 183 (20 residues), see Phobius details amino acids 195 to 213 (19 residues), see Phobius details amino acids 226 to 245 (20 residues), see Phobius details PF01925: TauE" amino acids 6 to 239 (234 residues), 95.7 bits, see alignment E=1.7e-31

Best Hits

KEGG orthology group: K07090, (no description) (inferred from 68% identity to acd:AOLE_00115)

Predicted SEED Role

"membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (247 amino acids)

>MPMX26_03016 hypothetical protein (Acinetobacter radioresistens SK82)
MLGYVIGVFAVAGMIKGTIGLGLPAVSMGLLSLVISPFQAATLLIIPSMVTNFWQLFAEG
HVVRLIRRFWPMLVGIVTGTIWSIFPTLGETDTAFHSEILLGAMLVLYGLYGLCAKNMPN
LAPYEKWLSPAIGYLGGALTVATGVVVIPVVPYLQSLQLKKDDLVQSLGLAFTVSTLCLA
IFLHQNPVDNTPIDYTLSMIALIPALIGMWLGTKIRYQISEQKFRKVFFIGLVLFGSYMM
LHQLGWL