Protein Info for MPMX26_03014 in Acinetobacter radioresistens SK82

Annotation: Putative pyrimidine permease RutG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 431 transmembrane" amino acids 32 to 53 (22 residues), see Phobius details amino acids 59 to 75 (17 residues), see Phobius details amino acids 82 to 103 (22 residues), see Phobius details amino acids 109 to 132 (24 residues), see Phobius details amino acids 142 to 161 (20 residues), see Phobius details amino acids 173 to 190 (18 residues), see Phobius details amino acids 197 to 218 (22 residues), see Phobius details amino acids 246 to 264 (19 residues), see Phobius details amino acids 319 to 337 (19 residues), see Phobius details amino acids 348 to 373 (26 residues), see Phobius details amino acids 385 to 403 (19 residues), see Phobius details amino acids 408 to 426 (19 residues), see Phobius details TIGR00801: uracil-xanthine permease" amino acids 27 to 422 (396 residues), 358.5 bits, see alignment E=2.5e-111 PF00860: Xan_ur_permease" amino acids 30 to 399 (370 residues), 309.7 bits, see alignment E=1.3e-96

Best Hits

Swiss-Prot: 64% identical to RUTG_ECOLI: Putative pyrimidine permease RutG (rutG) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 86% identity to acd:AOLE_00125)

MetaCyc: 64% identical to pyrimidine:H+ symporter (Escherichia coli K-12 substr. MG1655)
RXN-5076; TRANS-RXN-132; TRANS-RXN-362

Predicted SEED Role

"Uracil permease" in subsystem De Novo Pyrimidine Synthesis or Pyrimidine utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (431 amino acids)

>MPMX26_03014 Putative pyrimidine permease RutG (Acinetobacter radioresistens SK82)
MSNWFPKWRPYAGHIDQRPVSTNEYLPPAQSVVLGIQHAFAMFGATVLAPLLMGFDPNLA
ILMSGICTILFFLITGGRLPSYLGSSFAFIGVVAAASGHAIGSGVNPNLAVALGGIVACG
VFYAVIGFIVMLTGTRWIEKLMPPVVTGAVVMIIGLNLAPVTVKSVAGNQFDMWMALLTV
LSMGMIAVFTRGLLQRLLLLVGLLLSYLLYFIISNVLGYGKPIDFSVISNAAWFGLPSMT
TPRFEMNAMLIIAPVALILVAENLGHIKAVGAMTGENLTPHLGKAFVADGIATSLSGSVG
APGMTTYGENIGVMAITRVYSTIIFVIAGIFAIFLGLSPKFGAVISTIPTAILTGASIVV
FGLITIAGAKIWIENKVNFANNKNLVVAAVTIILGAGNFELVFGNFNLGGIGTATFAAIL
LNWFFSLKDKT