Protein Info for MPMX26_03008 in Acinetobacter radioresistens SK82

Annotation: Chaperone protein DnaJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 370 PF00226: DnaJ" amino acids 5 to 67 (63 residues), 107.9 bits, see alignment E=3.3e-35 TIGR02349: chaperone protein DnaJ" amino acids 5 to 348 (344 residues), 469.9 bits, see alignment E=3.2e-145 PF01556: DnaJ_C" amino acids 120 to 332 (213 residues), 165.5 bits, see alignment E=1.3e-52 PF00684: DnaJ_CXXCXGXG" amino acids 147 to 207 (61 residues), 60.8 bits, see alignment E=1.8e-20

Best Hits

Swiss-Prot: 96% identical to DNAJ_ACIB5: Chaperone protein DnaJ (dnaJ) from Acinetobacter baumannii (strain AB0057)

KEGG orthology group: K03686, molecular chaperone DnaJ (inferred from 96% identity to abb:ABBFA_000036)

MetaCyc: 61% identical to chaperone protein DnaJ (Escherichia coli K-12 substr. MG1655)
1.8.4.-

Predicted SEED Role

"Chaperone protein DnaJ" in subsystem Heat shock dnaK gene cluster extended or Protein chaperones

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (370 amino acids)

>MPMX26_03008 Chaperone protein DnaJ (Acinetobacter radioresistens SK82)
MAKRDYYEVLGVSKTASDDEIKKAYRKLAMKYHPDRNPDNPEAEEKFKEASEAYEVLSDS
EKRSMYDRMGHSAFEGGFGGAGGGFGGFSAEDIFSQFGDIFGGAFGGGGRQQRQRRGSDL
RYVMELTLEEAVRGVKKTITFNAPAPCEVCHGKGSKNPNDVETCKTCHGAGQVRMQQGFF
SVQQTCSTCRGQGKIIKNPCHACHGSGVADRQQTLEVTIPAGVDNGDRVRLSGKGEAIRD
GQSGDLYVEVVVREHEIFQRDGADLYMDVPVSIADAALGKEIQIPTLEGRVSLKIPEGTQ
TGKLFRLRGKGVRPVRSSMVGDLLCRIVIETPVNLTSHQRELLKELQASFDGEDSTSSPK
KKSFFDRLFD