Protein Info for MPMX26_03004 in Acinetobacter radioresistens SK82

Annotation: Inner membrane transport protein YdhP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 388 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 44 to 65 (22 residues), see Phobius details amino acids 72 to 93 (22 residues), see Phobius details amino acids 104 to 124 (21 residues), see Phobius details amino acids 131 to 152 (22 residues), see Phobius details amino acids 158 to 180 (23 residues), see Phobius details amino acids 202 to 224 (23 residues), see Phobius details amino acids 236 to 256 (21 residues), see Phobius details amino acids 268 to 287 (20 residues), see Phobius details amino acids 293 to 311 (19 residues), see Phobius details amino acids 325 to 349 (25 residues), see Phobius details amino acids 355 to 375 (21 residues), see Phobius details PF07690: MFS_1" amino acids 10 to 329 (320 residues), 127.2 bits, see alignment E=1.1e-40 PF06779: MFS_4" amino acids 15 to 371 (357 residues), 32.2 bits, see alignment E=1.1e-11 PF00083: Sugar_tr" amino acids 41 to 175 (135 residues), 24.4 bits, see alignment E=2e-09

Best Hits

Swiss-Prot: 66% identical to YDHP_ECOLI: Inner membrane transport protein YdhP (ydhP) from Escherichia coli (strain K12)

KEGG orthology group: K08156, MFS transporter, DHA1 family, arabinose polymer transporter (inferred from 78% identity to abm:ABSDF3631)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (388 amino acids)

>MPMX26_03004 Inner membrane transport protein YdhP (Acinetobacter radioresistens SK82)
MKINFPLLALAVGAFAIGTTEFSPMGLLPDIAGDLDVSIPRAGMLITGYALGVMLGAPVM
TLWFSSFSRRKALILLMAIFTIGNLLAAVSPSYMSLMGARLITSLNHGAFFGIGSVVAAS
VVPVHKQTSAVAAMFMGLTVANIGGVPLATWVGQNIGWRMSFLAITGLGLLTILSLWKAL
PKDHKGSRPDVRAELKVLTRRPVILAMLTTVLASGAMFTLYTYIAPSLVEFTQASPGFIT
LMLVLIGIGFSIGNHLGGKFADLSLDKTLIGFFVLLIVSMLLFPLLAKSPLGAAVGLVIW
GIATFALVPPLQMRVMSTAHDAPGLASSVNIGAFNLGNALGAVAGGAVLSMGWSYMAVPV
SGAVLSIVGLLLVFIQRKGQQPSIACES