Protein Info for MPMX26_02995 in Acinetobacter radioresistens SK82

Annotation: Adenine DNA glycosylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 343 TIGR01084: A/G-specific adenine glycosylase" amino acids 6 to 275 (270 residues), 349.7 bits, see alignment E=6.4e-109 PF00730: HhH-GPD" amino acids 35 to 166 (132 residues), 71.1 bits, see alignment E=1.4e-23 PF00633: HHH" amino acids 99 to 125 (27 residues), 26.3 bits, see alignment (E = 7.2e-10) PF14815: NUDIX_4" amino acids 234 to 340 (107 residues), 75.5 bits, see alignment E=4.3e-25

Best Hits

KEGG orthology group: K03575, A/G-specific adenine glycosylase [EC: 3.2.2.-] (inferred from 76% identity to abc:ACICU_03630)

Predicted SEED Role

"A/G-specific adenine glycosylase (EC 3.2.2.-)" in subsystem DNA repair, bacterial (EC 3.2.2.-)

Isozymes

Compare fitness of predicted isozymes for: 3.2.2.-

Use Curated BLAST to search for 3.2.2.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (343 amino acids)

>MPMX26_02995 Adenine DNA glycosylase (Acinetobacter radioresistens SK82)
MSEFSFSHALLEWFDVHGRHDLPWQVSDDPYKVWVSEIMLQQTQVKTVLQYFDRFIQRFP
TVNDLGLASWDEVAPYWAGLGYYARARNLHKAAGIVSREGKFPDSLDGWIALPGIGRSTA
GALMSLGLRQYGVIMDGNVKRVLARFFAIEEDLSQPVQERRLWKLAEELCPTERNHDYTQ
AIMDLGATICTPKKPLCLYCPMQEHCLAHQQGLETELPYKKPKKPVPLKQGHILLLQSQD
QWLWQQRPASGLWGGLYCLPIIEDKQQFSQLLAQYGLKQKQAPVQITHGFTHFTWLLDTY
LFHVEPEQREFLQTELGGEWLSPEQALMRGLPTAMKKLIQLIE