Protein Info for MPMX26_02971 in Acinetobacter radioresistens SK82

Annotation: 6,7-dimethyl-8-ribityllumazine synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00885: DMRL_synthase
  • amino acids 17 to 154 (138 residues), 192.8 bits, E=1.3e-61
• TIGR00114: 6,7-dimethyl-8-ribityllumazine synthase
  • amino acids 17 to 152 (136 residues), 178.1 bits, E=4.6e-57

Best Hits

Swiss-Prot: 94% identical to RISB_ACIAD: 6,7-dimethyl-8-ribityllumazine synthase (ribH) from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)

KEGG orthology group: K00794, 6,7-dimethyl-8-ribityllumazine synthase [EC: 2.5.1.78] (inferred from 92% identity to acd:AOLE_00435)

MetaCyc: 64% identical to 6,7-dimethyl-8-ribityllumazine synthase (Escherichia coli K-12 substr. MG1655)
LUMAZINESYN-RXN [EC: 2.5.1.78]

Predicted SEED Role

"6,7-dimethyl-8-ribityllumazine synthase (EC 2.5.1.78)" (EC 2.5.1.78)

MetaCyc Pathways

• flavin biosynthesis I (bacteria and plants) (8/9 steps found)
• flavin biosynthesis III (fungi) (7/9 steps found)
• flavin biosynthesis II (archaea) (5/10 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.78

Protein Sequence (156 amino acids)

>MPMX26_02971 6,7-dimethyl-8-ribityllumazine synthase (Acinetobacter radioresistens SK82)
MAIRRIEGLLHLASEGRYAILVGRFNSFVVEHLLEGAIDTLKRHGVSEENITVVHAPGAW
ELPVVAKKLAATDKFDAIIALGAVIRGSTPHFDFVAGECAKGLGVVGLDTGLPVINGVLT
TDSIEQAIERSGTKAGNKGSEAALTAIEMVNLLKAI