Protein Info for MPMX26_02962 in Acinetobacter radioresistens SK82

Annotation: Nicotinate phosphoribosyltransferase 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01514: nicotinate phosphoribosyltransferase
  • amino acids 4 to 397 (394 residues), 565 bits, E=4.8e-174
• PF17767: NAPRTase_N
  • amino acids 9 to 131 (123 residues), 120.5 bits, E=5.3e-39
• PF04095: NAPRTase
  • amino acids 172 to 398 (227 residues), 308.9 bits, E=2.8e-96

Best Hits

Swiss-Prot: 90% identical to PNCB_ACIBT: Nicotinate phosphoribosyltransferase (pncB) from Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377)

KEGG orthology group: K00763, nicotinate phosphoribosyltransferase [EC: 2.4.2.11] (inferred from 90% identity to aby:ABAYE0102)

Predicted SEED Role

"Nicotinate phosphoribosyltransferase (EC 2.4.2.11)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation or Redox-dependent regulation of nucleus processes (EC 2.4.2.11)

MetaCyc Pathways

• NAD salvage pathway I (PNC VI cycle) (5/7 steps found)
• NAD salvage pathway V (PNC V cycle) (3/5 steps found)
• NAD salvage (plants) (5/11 steps found)
• superpathway of NAD biosynthesis in eukaryotes (6/14 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Nicotinate and nicotinamide metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.11

Protein Sequence (402 amino acids)

>MPMX26_02962 Nicotinate phosphoribosyltransferase 2 (Acinetobacter radioresistens SK82)
MSAIIHSLLDTDLYKFTMLQVVLHKFPQTDSVYHFRCRNLEDTVYPLSDILDELNQQLDY
LCQLTFKEDELQYLRNLRFIKSDFVDYLELFQLKRRFIKASIDAEGRLDIWIEGPMVQAM
MFEIFVLALVNELYFRRIRSKEVLDEGERRLQAKLELIKSYERGQQPNDPPFLVSDFGTR
RRYSFEWQKHVIEEFHKASPSVFRGTSNVLLAKELGITPIGTMAHEFLQAFQALDVRLRN
FQKAALETWVQEYRGDLGIALTDVVGMDAFLRDFDLYFAKLFDGLRHDSGDPYEWGDKAY
KHYRKLKIDSRTKMLTFSDGLNLEKAWKLHQYFKDRFQVSFGIGTNLTNDMGQTPLNIVL
KLVECNGQSVAKISDSPGKTMTDNDTFLAYLRQVFDIQEPEV