Protein Info for MPMX26_02941 in Acinetobacter radioresistens SK82

Annotation: Acetyl esterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 303 PF10340: Say1_Mug180" amino acids 67 to 214 (148 residues), 60 bits, see alignment E=2.9e-20 PF20434: BD-FAE" amino acids 70 to 165 (96 residues), 34.8 bits, see alignment E=2e-12 PF07859: Abhydrolase_3" amino acids 75 to 277 (203 residues), 203.1 bits, see alignment E=6.9e-64

Best Hits

Swiss-Prot: 66% identical to EST_ACILW: Esterase (est) from Acinetobacter lwoffii

KEGG orthology group: None (inferred from 66% identity to acd:AOLE_00665)

Predicted SEED Role

"FIG00352107: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (303 amino acids)

>MPMX26_02941 Acetyl esterase (Acinetobacter radioresistens SK82)
MKIDPIFKQFLAESLLKSLVRKPSQFALPLPVLRTAFNQLGRVFPKNPEVEIRALRLAGV
RAEEIKPQPNATQMILHIHGGAFFLGGLATHRSFMTELAARTQMQVVHIDYPLAPEHPYP
EALEAVYDIYQTLLDQDIQPKDIILSGDSCGANLALALILRLKQNEQPLPSALVLMSPFL
DLTLTSESLRYNRKLDALLSVELLERGIEYYVPPSIDTADPQVSPLFGDFSGLPPTLVQV
GSKEILLDDAQRFKEKAEAAGVEVDFKIYTGMWHNFSMFSAWFDESKQALADLSEFAHRI
DRS