Protein Info for MPMX26_02936 in Acinetobacter radioresistens SK82

Annotation: Glutathione synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 PF02951: GSH-S_N" amino acids 1 to 119 (119 residues), 146.4 bits, see alignment E=6e-47 TIGR01380: glutathione synthase" amino acids 1 to 310 (310 residues), 434.3 bits, see alignment E=1.1e-134 PF02955: GSH-S_ATP" amino acids 123 to 296 (174 residues), 251.1 bits, see alignment E=6.5e-79 PF08443: RimK" amino acids 137 to 307 (171 residues), 50.5 bits, see alignment E=3e-17

Best Hits

Swiss-Prot: 63% identical to GSHB_PSEPK: Glutathione synthetase (gshB) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K01920, glutathione synthase [EC: 6.3.2.3] (inferred from 90% identity to aby:ABAYE0147)

MetaCyc: 57% identical to glutathione synthetase (Escherichia coli K-12 substr. MG1655)
Glutathione synthase. [EC: 6.3.2.3]

Predicted SEED Role

"Glutathione synthetase (EC 6.3.2.3)" in subsystem Glutathione: Biosynthesis and gamma-glutamyl cycle or Heat shock dnaK gene cluster extended (EC 6.3.2.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (314 amino acids)

>MPMX26_02936 Glutathione synthetase (Acinetobacter radioresistens SK82)
MRVLVVMDPIENVNLKKDSTMAMLWAASRRGHELGYALQQDLYIDQGKAWGLISPLKVFE
DYNHYYELGEKQKESIAAYDVVLMRKDPPFDMNFVYTTYILEQAEREGARIVNKPQSLRD
CNEKLFATQFPELQVPTLVTSQQQLIREFIAEHQDVIVKPLDGMGGAGIFRLSATGANIG
STLEMLTQLGQQPIMAQRYIPEIVDGDKRILMINGEPVPYCLARIPQNGEIRGNLAAGGL
GEARLLTENDKAIAAKVGPYLREKGLIFVGLDVIGNYVTEINVTSPTCIREIDNQFGTSI
ADDLFEALENSSSA