Protein Info for MPMX26_02917 in Acinetobacter radioresistens SK82

Annotation: Single-stranded-DNA-specific exonuclease RecJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 570 TIGR00644: single-stranded-DNA-specific exonuclease RecJ" amino acids 22 to 562 (541 residues), 508 bits, see alignment E=1.3e-156 PF01368: DHH" amino acids 71 to 225 (155 residues), 103.7 bits, see alignment E=1.3e-33 PF02272: DHHA1" amino acids 350 to 447 (98 residues), 71.5 bits, see alignment E=1e-23 PF17768: RecJ_OB" amino acids 460 to 563 (104 residues), 89.8 bits, see alignment E=1.8e-29

Best Hits

KEGG orthology group: K07462, single-stranded-DNA-specific exonuclease [EC: 3.1.-.-] (inferred from 77% identity to acd:AOLE_00795)

Predicted SEED Role

"Single-stranded-DNA-specific exonuclease RecJ (EC 3.1.-.-)" in subsystem DNA-replication or DNA Repair Base Excision or DNA repair, bacterial RecFOR pathway (EC 3.1.-.-)

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-

Use Curated BLAST to search for 3.1.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (570 amino acids)

>MPMX26_02917 Single-stranded-DNA-specific exonuclease RecJ (Acinetobacter radioresistens SK82)
MPNIQVKQRPLLTRVESFQHVSPFLAHILARRGVASEQELELRLKYLLSPCLKGLEQAVE
IINQAIDQQKKIVIVGDYDADGATSTALMILALRDMGADVAYLVPDRFKYGYGLTPAIAD
LAFTRFTPDLLITVDNGISSHEGVKQAQDHGMQVIITDHHLTTKETPAAEAVVNPNQLGC
NFPSKALAGVGVAFYVLANLCSFRKRADQSVSNITQYLDLVALGTYADVASLDYNNRILV
DAGLKRIQQQQCRPGILALLDIAGREPAALKAQDLGFVLGPRINAAGRMETMEIGIECLL
APDLENAYPLARQLNQLNIERRQIEAQMKQEALRYLEQLQLSKENIPPALIMFEEHWHQG
VIGIVAGRLKEQFHRPSIVFAADEDGIHIKGSARSVEGIHIRDCIEQIAEQYPHLVRYFG
GHAAAAGLTIRKEHFLEFKQVFIQLIAGMDETLLSATLWTDGELPVEALVLDTVDLIEKL
GPWGQKFPSPVFEGIFKVVDFRWLKETHLKLRLALNNGQVVDAIAFNAKDRFEYDPENDQ
VDLVYELERNEFNGNTGLQLRIIHLKQKIL