Protein Info for MPMX26_02905 in Acinetobacter radioresistens SK82

Annotation: putative FMNH2-dependent monooxygenase SfnC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 402 PF02771: Acyl-CoA_dh_N" amino acids 36 to 123 (88 residues), 36.8 bits, see alignment E=6.8e-13 PF08028: Acyl-CoA_dh_2" amino acids 243 to 377 (135 residues), 65.8 bits, see alignment E=7.4e-22 PF00441: Acyl-CoA_dh_1" amino acids 249 to 374 (126 residues), 50.8 bits, see alignment E=3.2e-17

Best Hits

Swiss-Prot: 54% identical to SFNC_PSEPU: Probable FMNH2-dependent monooxygenase SfnC (sfnC) from Pseudomonas putida

KEGG orthology group: None (inferred from 77% identity to aci:ACIAD3474)

Predicted SEED Role

"Acyl-CoA dehydrogenase; probable dibenzothiophene desulfurization enzyme"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (402 amino acids)

>MPMX26_02905 putative FMNH2-dependent monooxygenase SfnC (Acinetobacter radioresistens SK82)
MSILDKSLMNTTENSYSAEQAIQTAQQLTRLFSHTAALRDKQGGNPKKERDLIRESGLLK
LSIPTEYGGSGANWTTIFETIRIIAQADSSLAHVYGFHHLLIATVQLFAQPQQYASWFKQ
TAQDNLFWGNALNPLDRRTTVTRITDHEYVFQGDKSFCSGSIDSDLLLCSGYDEQGKLLI
GVIPSQRNGVSFLGDWDNMGQRQTDSGTSHFEQVHVYKKELLLNPGPLSTPYSSLRPLIA
QLIFVHLFLGVAEGAFEAAKAVVQGQKAWSKSLAEQAVDDPYIQKHFAEFYVQLEGVRLL
AADAVKKLQAAWLQGEHLSSVQRGEVSIAIATAKIAATNTSLYITQNIFQVMGARATAAK
LNLDRFWRNVRTQTLHDPVDYKYQEIGEWILTGKLPEPSFYS