Protein Info for MPMX26_02898 in Acinetobacter radioresistens SK82

Annotation: Cation/acetate symporter ActP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 571 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 40 to 59 (20 residues), see Phobius details amino acids 80 to 102 (23 residues), see Phobius details amino acids 108 to 127 (20 residues), see Phobius details amino acids 153 to 174 (22 residues), see Phobius details amino acids 184 to 207 (24 residues), see Phobius details amino acids 217 to 237 (21 residues), see Phobius details amino acids 277 to 299 (23 residues), see Phobius details amino acids 311 to 336 (26 residues), see Phobius details amino acids 376 to 403 (28 residues), see Phobius details amino acids 425 to 444 (20 residues), see Phobius details amino acids 450 to 473 (24 residues), see Phobius details amino acids 482 to 502 (21 residues), see Phobius details amino acids 520 to 539 (20 residues), see Phobius details TIGR00813: transporter, solute:sodium symporter (SSS) family" amino acids 68 to 489 (422 residues), 212.3 bits, see alignment E=6.4e-67 PF00474: SSF" amino acids 68 to 489 (422 residues), 383.3 bits, see alignment E=7.1e-119

Best Hits

Swiss-Prot: 64% identical to ACTP_YERP3: Cation/acetate symporter ActP (actP) from Yersinia pseudotuberculosis serotype O:1b (strain IP 31758)

KEGG orthology group: K14393, cation/acetate symporter (inferred from 91% identity to acd:AOLE_00885)

Predicted SEED Role

"Acetate permease ActP (cation/acetate symporter)" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (571 amino acids)

>MPMX26_02898 Cation/acetate symporter ActP (Acinetobacter radioresistens SK82)
MKWNSCKAKVFAASTFLTSGLAMAGPDLGAAEQQATNWHAIIMFVIFVGLTLFITKWAAK
QTQSTQDFYTAGGGISGFQNGLAIAGDFMSAASFLGISAMVFSSGFDGLLYSLGFMVGWP
IVLFLIAERLRNLGKYNLSDVVSFRLEEKPVRTLAAISSLVVVAFYLIAQMVGAGQLIKL
LFGLNYNIAVVIVGLLMMAYVMFGGMLATTWVQIIKAVMLLSGATFMAFMVMKGVGFSFT
AMFDQSIQIFAKVHDITLAEAGKIMGPGKLAENPIDAISLGLALMFGTAGLPHILMRFFT
VKDAKEARKSVVVATGFIGYFYLLTFIIGFGAILYVSNNPQFIDVAKMAVTGKLELVGGN
NMAAVHLADAVGGDLFMGFISAVAFATILAVVAGLTLSGASAISHDLYANVFKKGQTTPE
SELRMSKIATLGLAIFAMILGILFEKQNVAFMVGLAFSVAACANFPVLVLSMFWKGLTTR
GAVAGGVVGLSLAVILIVLSKAVWVDTLGISDTPINPFNGPAIFAMPLSFFCCWLFSVTD
KSARAQRERKEFDAQFVRSMTGIGASGAQDH