Protein Info for MPMX26_02853 in Acinetobacter radioresistens SK82

Annotation: Homoserine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 316 PF01636: APH" amino acids 26 to 254 (229 residues), 99.5 bits, see alignment E=1.4e-32

Best Hits

Swiss-Prot: 36% identical to KHSE_CUPNJ: Homoserine kinase (thrB) from Cupriavidus necator (strain JMP 134 / LMG 1197)

KEGG orthology group: K02204, homoserine kinase type II [EC: 2.7.1.39] (inferred from 68% identity to abm:ABSDF0228)

Predicted SEED Role

"Homoserine kinase (EC 2.7.1.39)" in subsystem Methionine Biosynthesis or Threonine and Homoserine Biosynthesis (EC 2.7.1.39)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.39

Use Curated BLAST to search for 2.7.1.39

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (316 amino acids)

>MPMX26_02853 Homoserine kinase (Acinetobacter radioresistens SK82)
MSVYTPLSLKEVQSFAAPYGLKVQELIPIQGGIQNTNYFLVNEDGSQFVLTVFEEMNAAQ
AGELVPVLEHLGNAHLPVAVPLKQAEAAIGQIAGKPAQIAPRLVGEHPIPANTAQTAEVA
RAQAKLHVALQDFDFERQSYRNHSYWSQVAAELRPDMDVQDQLLLDSVFQQFEVFQAKYP
QRPLGFIHSDLFRDNTLFEGDTLKGILDFYELNHDELLFDIAITINDFCSDYPAVKLDQT
RVQAYLENYQTVRMLTEDEKACLPVYLAMAACRFWLMRLQVAQKNAQEQRGGEDILQKDP
LEMRNMLQNRLALIGK