Protein Info for MPMX26_02837 in Acinetobacter radioresistens SK82

Annotation: Protein YhgF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 785 PF09371: Tex_N" amino acids 3 to 76 (74 residues), 99.2 bits, see alignment E=4e-32 PF22706: Tex_central_region" amino acids 132 to 300 (169 residues), 124.4 bits, see alignment E=2.4e-39 PF16921: Tex_YqgF" amino acids 317 to 442 (126 residues), 169 bits, see alignment E=2.7e-53 PF14635: HHH_7" amino acids 455 to 547 (93 residues), 40.6 bits, see alignment E=1.3e-13 PF12836: HHH_3" amino acids 482 to 546 (65 residues), 95.6 bits, see alignment E=6.8e-31 PF17674: HHH_9" amino acids 552 to 621 (70 residues), 87.3 bits, see alignment E=4.7e-28 PF23459: S1_RRP5" amino acids 639 to 709 (71 residues), 37.1 bits, see alignment E=1.7e-12 PF00575: S1" amino acids 640 to 711 (72 residues), 77.7 bits, see alignment E=3.2e-25

Best Hits

KEGG orthology group: K06959, uncharacterized protein (inferred from 88% identity to acd:AOLE_01310)

Predicted SEED Role

"Transcription accessory protein (S1 RNA-binding domain)" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (785 amino acids)

>MPMX26_02837 Protein YhgF (Acinetobacter radioresistens SK82)
MTDLVQQLASELAVRPDQVEAAIKLIDEGASVPFIARYRKEVTQGLDDTQLRQLDTRLSY
LRDLNERRAKVIESLKEQNKLSDDLLARVEAVETKNALEEIYAPYRPKRTSKSFKAREAG
LGPVAEKILAEQVDPSEALAGFSHEEYPDLESQLDAIQHIIIDEWAQNIALTAELKANFA
KTAVLKSAVASEEKKEVGKKFRDYFEFSENLNKVPSHRLLAMLRGRQENVLGLKVDGEND
PAIQRIEVEYQLDQIQPQTRQDFLKQTAKLFWMGKVRPQVEHSLLTEKRLAAENEAMQVF
AENLRHLLLSAPAGSRRTLGVDPGIRTGVKLAVVNESGDVLAHSTIYPFAPKEDKEGSVA
ELARLCREFNIELIAIGNGTASRETEAVVAEMMAANPDLKLTRVTVSEAGASVYSASELA
SQELPELDVSIRGAVSIARRLQDPLAELVKIDPKSIGVGQYQHDVNQAGLAKTLDAVVED
CVNAVGVDVNTASSAILGYIAGLNKAIAQQIVEYRKENGRFDNRQDLKKVPRLGDRTFEQ
AAGFLRIQEGNQPLDASSVHPESYGLVEKIVEAKATTVKDIIGNSEIIRQVDPNQFIDDK
FGLPTIQDVLAELEKPGRDPRPEFRTAKFRDDITDVKQLTEGMQLEGVVTNVTNFGAFVD
IGVHQDGLVHISELANEFVSDPHKIVKPGQIVQVRVIQVDAERNRVNLSMRPEGAAAPVK
TSPRPRREQNQEQRPERKPQGKRPQHARPQGERPQGKKPQAAKPQEQKIGGLGALLLQAG
IKGSK