Protein Info for MPMX26_02834 in Acinetobacter radioresistens SK82

Annotation: Fatty acyl-CoA reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00106: adh_short
  • amino acids 16 to 205 (190 residues), 181.7 bits, E=2.3e-57
• PF08659: KR
  • amino acids 18 to 182 (165 residues), 48.1 bits, E=2.7e-16
• PF01370: Epimerase
  • amino acids 18 to 153 (136 residues), 22.8 bits, E=1.1e-08
• PF13561: adh_short_C2
  • amino acids 22 to 207 (186 residues), 122.7 bits, E=3.8e-39

Best Hits

Swiss-Prot: 81% identical to ACR1_ACIAD: Fatty acyl-CoA reductase (acr1) from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)

KEGG orthology group: None (inferred from 84% identity to abb:ABBFA_000289)

Predicted SEED Role

"3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100)" in subsystem Fatty Acid Biosynthesis FASII or mycolic acid synthesis (EC 1.1.1.100)

MetaCyc Pathways

• superpathway of fatty acids biosynthesis (E. coli) (47/53 steps found)
• superpathway of fatty acid biosynthesis II (plant) (38/43 steps found)
• palmitate biosynthesis II (type II fatty acid synthase) (29/31 steps found)
• oleate biosynthesis IV (anaerobic) (13/14 steps found)
• superpathway of fatty acid biosynthesis I (E. coli) (14/16 steps found)
• biotin biosynthesis I (13/15 steps found)
• superpathway of unsaturated fatty acids biosynthesis (E. coli) (16/20 steps found)
• palmitoleate biosynthesis I (from (5Z)-dodec-5-enoate) (8/9 steps found)
• fatty acid elongation -- saturated (5/5 steps found)
• gondoate biosynthesis (anaerobic) (4/4 steps found)
• 8-amino-7-oxononanoate biosynthesis I (9/11 steps found)
• (5Z)-dodecenoate biosynthesis I (5/6 steps found)
• stearate biosynthesis II (bacteria and plants) (5/6 steps found)
• 8-amino-7-oxononanoate biosynthesis IV (4/5 steps found)
• octanoyl-[acyl-carrier protein] biosynthesis (mitochondria, yeast) (9/12 steps found)
• palmitate biosynthesis III (21/29 steps found)
• (5Z)-dodecenoate biosynthesis II (4/6 steps found)
• stearate biosynthesis IV (4/6 steps found)
• cis-vaccenate biosynthesis (3/5 steps found)
• tetradecanoate biosynthesis (mitochondria) (17/25 steps found)
• petroselinate biosynthesis (1/6 steps found)
• 2-allylmalonyl-CoA biosynthesis (2/8 steps found)
• streptorubin B biosynthesis (20/34 steps found)
• anteiso-branched-chain fatty acid biosynthesis (19/34 steps found)
• even iso-branched-chain fatty acid biosynthesis (19/34 steps found)
• odd iso-branched-chain fatty acid biosynthesis (19/34 steps found)
• mycolate biosynthesis (22/205 steps found)
• superpathway of mycolate biosynthesis (23/239 steps found)

KEGG Metabolic Maps

• Biosynthesis of unsaturated fatty acids
• Fatty acid biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.100

Use Curated BLAST to search for 1.1.1.100

Protein Sequence (295 amino acids)

>MPMX26_02834 Fatty acyl-CoA reductase (Acinetobacter radioresistens SK82)
MNNKLEKLFKDKVNGKVALITGASSGIGLTTAKKLAQAGAHVLLVARTESTLQEVQAEIE
AEGGKATIFPCDLNDLDAIDACSQKILASVDHIDILINNAGRSIRRAVHESIDRFHDFER
TMQLNYFGAIRLILNILPQMMQRRDGQIINISSIGVLANATRFSAYVASKAALDAFSRCL
SAEVHSHKIAITSIYMPLVRTPMIAPTKIYRYVPTLSPEQAADLIAYAIIKRPKRLATHL
GRLASITYSIAPEINNMFMSIGFNLFPSSSASVGKQEKLNWVQRAYARIFPGEHW