Protein Info for MPMX26_02768 in Acinetobacter radioresistens SK82

Annotation: Putative transport protein YdiK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 372 transmembrane" amino acids 7 to 25 (19 residues), see Phobius details amino acids 31 to 52 (22 residues), see Phobius details amino acids 64 to 86 (23 residues), see Phobius details amino acids 158 to 176 (19 residues), see Phobius details amino acids 211 to 234 (24 residues), see Phobius details amino acids 240 to 267 (28 residues), see Phobius details amino acids 276 to 297 (22 residues), see Phobius details amino acids 307 to 339 (33 residues), see Phobius details PF01594: AI-2E_transport" amino acids 12 to 343 (332 residues), 151.9 bits, see alignment E=1.3e-48

Best Hits

KEGG orthology group: None (inferred from 79% identity to aci:ACIAD3289)

Predicted SEED Role

"Putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (372 amino acids)

>MPMX26_02768 Putative transport protein YdiK (Acinetobacter radioresistens SK82)
MQQYAPTLQRVLLFGLFFILVFLGFHVLKYFIVPVLWAAIIAYMTWPLYLSIQRMCGQRS
SISASVMIVLIILVIGIPLTFAIFILQHEGRNLYYELQRQIFSGHVSVPDFIRELPIIGK
EVTRTLKELNTDPQSITQNVAAWIQGHLGYGRFVLNEISKNIIKLCFAIMSLFFFYRDGQ
TILRQVSTAMEKVIGPRIHHYMDTISETTRAVVYGVGLTAIAQAILAGLSYVVAGVPNPM
VLTIATFLLALIPFGTPVAYGSVALWLFSQGQTVEAIGVFAWGVCIVSTSDNVIRPLVIS
GATQIPFLLIMFGVLGGVASFGLVGLFIGPVILAVILAIWREWLHETTEPEPMPDASLAY
EILNDEEPPKSP