Protein Info for MPMX26_02745 in Acinetobacter radioresistens SK82

Annotation: GTP cyclohydrolase-2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00505: GTP cyclohydrolase II
  • amino acids 6 to 194 (189 residues), 260 bits, E=5.5e-82
• PF00925: GTP_cyclohydro2
  • amino acids 7 to 171 (165 residues), 216.4 bits, E=9.5e-69

Best Hits

Swiss-Prot: 88% identical to RIBA_ACIBC: GTP cyclohydrolase-2 (ribA) from Acinetobacter baumannii (strain ACICU)

KEGG orthology group: K01497, GTP cyclohydrolase II [EC: 3.5.4.25] (inferred from 88% identity to aby:ABAYE0379)

Predicted SEED Role

"GTP cyclohydrolase II (EC 3.5.4.25)" in subsystem Molybdenum cofactor biosynthesis or Riboflavin, FMN and FAD metabolism (EC 3.5.4.25)

MetaCyc Pathways

• flavin biosynthesis I (bacteria and plants) (8/9 steps found)
• flavin biosynthesis III (fungi) (7/9 steps found)
• 6-hydroxymethyl-dihydropterin diphosphate biosynthesis III (Chlamydia) (3/5 steps found)
• toxoflavin biosynthesis (3/7 steps found)
• flavin biosynthesis II (archaea) (5/10 steps found)

KEGG Metabolic Maps

• Riboflavin metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.5.4.25

Use Curated BLAST to search for 3.5.4.25

Protein Sequence (200 amino acids)

>MPMX26_02745 GTP cyclohydrolase-2 (Acinetobacter radioresistens SK82)
MPIEFVATSKLPTKFGEFKISVFQDPETGEEHVALSKGLETPPDGPVLVRIHSECLTGDA
FASLKCDCGPQLQATQQLINEAGQGVILYLRQEGRGIGLTNKIRAYALQDQGHDTVDANL
MLNLPADARHYDMCPIMLNHLGVKQVRLITNNPLKIKSLQDQGINVVDRIPLTVGLNPFN
EEYLKTKHKRMSHLYKKDDF