Protein Info for MPMX26_02735 in Acinetobacter radioresistens SK82

Annotation: Putative cytokinin riboside 5'-monophosphate phosphoribohydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 203 TIGR00730: TIGR00730 family protein" amino acids 12 to 189 (178 residues), 204 bits, see alignment E=7.7e-65 PF18306: LDcluster4" amino acids 13 to 125 (113 residues), 62.3 bits, see alignment E=4.3e-21 PF03641: Lysine_decarbox" amino acids 56 to 185 (130 residues), 147.1 bits, see alignment E=3.4e-47

Best Hits

Swiss-Prot: 44% identical to YVDD_BACSU: LOG family protein YvdD (yvdD) from Bacillus subtilis (strain 168)

KEGG orthology group: K06966, (no description) (inferred from 77% identity to acd:AOLE_02000)

Predicted SEED Role

"Lysine decarboxylase family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (203 amino acids)

>MPMX26_02735 Putative cytokinin riboside 5'-monophosphate phosphoribohydrolase (Acinetobacter radioresistens SK82)
MKNLQHGQHIMKAIGVFCGSAIGTEPVFLETAQAVGQAIAQRGQTLVYGGGRSGLMGVIA
DSALQAGGAVIGVIPHALVDRELAHPDLTELHVVQNMHERKTKMSELSDGFIALPGGAGT
LEEIFEQWTWAQLGIHQKPCAFLNLDGFYNDLLKMIQFTVDKGFTHSRFVEKLIASDNIE
QILQQFDQYQPPAPKWGTSGVNP