Protein Info for MPMX26_02697 in Acinetobacter radioresistens SK82

Annotation: 30S ribosomal protein S4

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01017: ribosomal protein uS4
  • amino acids 3 to 207 (205 residues), 273 bits, E=7.4e-86
• PF00163: Ribosomal_S4
  • amino acids 3 to 96 (94 residues), 106.1 bits, E=1.3e-34
• PF01479: S4
  • amino acids 98 to 144 (47 residues), 64.4 bits, 6.1e-22

Best Hits

Swiss-Prot: 97% identical to RS4_ACIAD: 30S ribosomal protein S4 (rpsD) from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)

KEGG orthology group: K02986, small subunit ribosomal protein S4 (inferred from 97% identity to aci:ACIAD3195)

MetaCyc: 70% identical to 30S ribosomal subunit protein S4 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"SSU ribosomal protein S4p (S9e)" in subsystem Ribosome SSU bacterial

Protein Sequence (207 amino acids)

>MPMX26_02697 30S ribosomal protein S4 (Acinetobacter radioresistens SK82)
MARYIGPKCKLSRREGTDLQLKSGVKPFDVKTKKHAKAPGQHGQSRAKQSEYSLQLREKQ
KVRRMYGVLERQFSNYYKEAARVKGATGENLLKLLESRLDNVVYRMGFGSTRAEARQLVS
HRSITLNGRRVNIASIQVKAGDVIAVHEGAKQQLRIKSAIELAAQRGIPAWIEVDHSKFE
GTFKAAPDRSDLPAEINESLIVELYSK