Protein Info for MPMX26_02694 in Acinetobacter radioresistens SK82

Annotation: FAD-containing monooxygenase EthA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 496 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF00743: FMO-like" amino acids 7 to 347 (341 residues), 49.1 bits, see alignment E=8.1e-17 PF13738: Pyr_redox_3" amino acids 8 to 211 (204 residues), 35.3 bits, see alignment E=1.9e-12 PF13450: NAD_binding_8" amino acids 9 to 62 (54 residues), 37.3 bits, see alignment 6.7e-13 PF13434: Lys_Orn_oxgnase" amino acids 93 to 264 (172 residues), 24.7 bits, see alignment E=3.1e-09

Best Hits

Swiss-Prot: 77% identical to ALMA_ACIAD: Probable FAD-binding monooxygenase AlmA (almA) from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)

KEGG orthology group: None (inferred from 77% identity to abc:ACICU_03251)

MetaCyc: 49% identical to ethionamide monooxygenase MymA (Mycobacterium tuberculosis H37Rv)
1.14.13.-; 1.14.13.-

Predicted SEED Role

"monooxygenase, flavin-binding family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (496 amino acids)

>MPMX26_02694 FAD-containing monooxygenase EthA (Acinetobacter radioresistens SK82)
MDKHIDVLIVGAGISGLGLAAHLSKNCPQRSFEIVERREGIGGTWDLFRYPGIRSDSDMS
TFGYNFKPWRKAKILADGASICQYLHEVVDEFHLDRKIHFKHRVISANYDTALKLWIVEI
EDQQGQNQTWYANFLLGCTGYYNYDEGFMPEYPGQDQFKGTLVHPQHWPEKLDYTGKRVI
VIGSGATAITLVPSMVKGGAAHVTMLQRSPTYIASIPSIDFVYQKMRGSLSEEMAYKLTR
ARNIGMQRAVYALSQKQPKLVRKLLLKSIELQLKGKVDMKHFTPSYNPWDQRLCVVPDGD
LFKALREGHASVETDHIEKFTETGIQLKSGKHLEADIIISATGLQIQIMGGIHGTVDGQP
IDTSEHMLYNGILISDVPNMAMIIGYINASWTLKVDVAAEYICRLLNYMDKHHYDEVIAP
TDHSEIEQDTVMGSLSAGYIRRAADVIPKQGKHAPWQVTNNYLADRKALKQASFEDGILQ
FTKRDKQLERKPKLVS