Protein Info for MPMX26_02684 in Acinetobacter radioresistens SK82

Annotation: Ribonuclease R

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 814 TIGR02063: ribonuclease R" amino acids 36 to 726 (691 residues), 763.7 bits, see alignment E=1.9e-233 TIGR00358: VacB and RNase II family 3'-5' exoribonucleases" amino acids 89 to 726 (638 residues), 646.2 bits, see alignment E=5.7e-198 PF08206: OB_RNB" amino acids 102 to 152 (51 residues), 28.6 bits, see alignment 1.9e-10 PF17876: CSD2" amino acids 177 to 253 (77 residues), 37.9 bits, see alignment E=3e-13 PF00773: RNB" amino acids 274 to 599 (326 residues), 355 bits, see alignment E=8.6e-110 PF00575: S1" amino acids 644 to 724 (81 residues), 40.7 bits, see alignment E=5.1e-14

Best Hits

KEGG orthology group: K12573, ribonuclease R [EC: 3.1.-.-] (inferred from 81% identity to aby:ABAYE0445)

Predicted SEED Role

"3'-to-5' exoribonuclease RNase R" in subsystem RNA processing and degradation, bacterial

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-

Use Curated BLAST to search for 3.1.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (814 amino acids)

>MPMX26_02684 Ribonuclease R (Acinetobacter radioresistens SK82)
MLKVSSDVKPNEIMKNWVDPEAKAEAERYDNPIPSRILIQKTIEQLQAPQSHADLVEHFE
IQDQKSIDALNHRLIAMVRDGQLVKDGFKFQLVADLPTYEATVYINTKGMGIAQIDGQDN
LYLPERELRLVFNGDRVRVRQTSTDRKGKAWGFITEVIQRRVKQIIGQLKMYEGEYFIQP
SMPNQHQPITLEKELIDHAKINLGDMVRVAIDDYPTREEFSTGHIVQSMADKADTEIIIP
QTILEYGLPYEFPEEVLKEAASFKEPDEQDRQGRVDLRDLALVTIDGEDARDFDDAVYAE
KRPGGGYRVVVAIADVSHYVRLGTALNEEAEERGTSVYFPHFVLPMLPEALSNGLCSLNP
HLDRLCMVCDLNVSRAGRVTQYEFYPAVMHSKARLTYTQVAAYLDGDSQAVPEDRTVRKS
LNTLFQLYQVLKELRAKRHAMEFETVETYMTFDELGGIKEILPRSRNEAHKLIEECMLLA
NVAAAEYSLKNEIPMLYRVHDAPEFSRTQKVRDYVKLLGLNFPEQPTQADYQAVIEATKD
RIDAPSIHAVLLRSMMQAYYGPENIGHYGLAYEAYTHFTSPIRRYPDLLLHRAIKAHLKH
KQFALSGNQLAEAGEHYSQTERRADEASRSVTMWLKCHYMQQHLGEEFDGIISAVTEFGL
FVTLKDLYVDGMLHVSQLGDDFFVYDQPSQSLIGQSRGQVFGLGDEVRIKVAGVQLEERK
IDFELVRQLTHAGRAVRSRAPRVAQVREENHGARNKDDSGEQPVRKKRNKSSKPSSYTKK
SGKKSAEKASVSKEAPKKKSKDKKRRSNAKSRQD