Protein Info for MPMX26_02652 in Acinetobacter radioresistens SK82

Annotation: Carboxypeptidase G2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 425 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF04389: Peptidase_M28" amino acids 102 to 217 (116 residues), 38.1 bits, see alignment E=2.8e-13 PF01546: Peptidase_M20" amino acids 114 to 417 (304 residues), 93.5 bits, see alignment E=3.4e-30 PF07687: M20_dimer" amino acids 217 to 318 (102 residues), 74 bits, see alignment E=1.8e-24

Best Hits

KEGG orthology group: K01295, glutamate carboxypeptidase [EC: 3.4.17.11] (inferred from 60% identity to ctt:CtCNB1_0044)

Predicted SEED Role

"Glutamate carboxypeptidase (EC 3.4.17.11)" (EC 3.4.17.11)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.17.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (425 amino acids)

>MPMX26_02652 Carboxypeptidase G2 (Acinetobacter radioresistens SK82)
MKRQLKYGIGIGVSLFICTSISHAASAQELIKVAESQKQHFLNTLKDLVNIESSSRDIEG
LNIIAKQVAQQLKNTGAQVEIITNHDIYRMDDTPEQVGPVVKATLKGKGQTNIMLIAHMD
TVYPKGSLAKQPFRIEGDKAYGLGIIDDKQGVASIIHILSILKKLNYQDYGTITVLMNSD
EEISSPGSRKLISKIAQQQDVIFSFEGGGTDGSLRLATSGIGAAYLEVKGKASHAGVKPE
DGVNALTELSHQILQLQDLSDAKTGLKLNWTVATAGKTRNAIPEEAQAQADVRALDNADF
KKVERILAERIKNKKLKDSQVAVKFELRRPPLSASEQARSIAKQAQQIYLQEFKQPLNIL
TEATGGGTDAAFAALDSKAAVIEGMGVSGYGAHSNQAEYILVESIVPRLYMATRLIMDIS
EQKNK