Protein Info for MPMX26_02646 in Acinetobacter radioresistens SK82

Annotation: putative acyl-CoA thioester hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 140 PF03061: 4HBT" amino acids 27 to 99 (73 residues), 69.2 bits, see alignment E=1.6e-23

Best Hits

Swiss-Prot: 52% identical to Y254_BUCBP: Uncharacterized acyl-CoA thioester hydrolase bbp_254 (bbp_254) from Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)

KEGG orthology group: K10806, acyl-CoA thioesterase YciA [EC: 3.1.2.-] (inferred from 90% identity to aci:ACIAD3139)

MetaCyc: 48% identical to acyl-CoA thioesterase YciA (Escherichia coli K-12 substr. MG1655)
Acyl-CoA hydrolase. [EC: 3.1.2.20]

Predicted SEED Role

"Acyl-CoA thioesterase YciA, involved in membrane biogenesis"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.2.-

Use Curated BLAST to search for 3.1.2.- or 3.1.2.20

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (140 amino acids)

>MPMX26_02646 putative acyl-CoA thioester hydrolase (Acinetobacter radioresistens SK82)
MSDTNLKPEGVLSLQTIAMPADTNWSGDVFGGWIVSQMDLAGAIHAERFSKGRCATISIN
QMTFLVPVKVGDVISCYTKILKVGNTSIQMQIEVWDSHDSSRPAKRVTEGVFTFVAVDVK
GNKRIIPEEVKQKFLEPQQV