Protein Info for MPMX26_02636 in Acinetobacter radioresistens SK82

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 241 PF20582: UPF0758_N" amino acids 5 to 81 (77 residues), 105.1 bits, see alignment E=1.6e-34 TIGR00608: DNA repair protein RadC" amino acids 13 to 226 (214 residues), 207.7 bits, see alignment E=9.1e-66 PF04002: RadC" amino acids 107 to 226 (120 residues), 125.1 bits, see alignment E=1.5e-40

Best Hits

Swiss-Prot: 73% identical to Y3126_ACIAD: UPF0758 protein ACIAD3126 (ACIAD3126) from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)

KEGG orthology group: K03630, DNA repair protein RadC (inferred from 73% identity to aci:ACIAD3126)

Predicted SEED Role

"DNA repair protein RadC" in subsystem DNA repair, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (241 amino acids)

>MPMX26_02636 hypothetical protein (Acinetobacter radioresistens SK82)
MQNSIKHWPEQERPRERLLQQGAQSLSDAELLAIFLRSGSRQHSAVELARQMIQHFGGLS
PVFDAELSDLSQFHGMGPSKYSQLMAVKELGRRYLQQYFHQPQLELNSSAQVLDYLRYEL
LGERQEVFAVLCLDNDLRKLSFKKLFFGSLNHCAVSINQILRYALKQHACHLVIAHNHPF
GQAQPSPADLELTRQLSQACKLVEIVLLDHFIISPECSFSFAEQGLFNTSEQVENKVDKA
G