Protein Info for MPMX26_02625 in Acinetobacter radioresistens SK82

Annotation: Transcriptional regulatory protein BaeR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 228 PF00072: Response_reg" amino acids 4 to 113 (110 residues), 95.8 bits, see alignment E=1.9e-31 PF00486: Trans_reg_C" amino acids 145 to 223 (79 residues), 83.6 bits, see alignment E=8.3e-28

Best Hits

KEGG orthology group: K07664, two-component system, OmpR family, response regulator BaeR (inferred from 92% identity to aci:ACIAD0627)

Predicted SEED Role

"Phosphate regulon transcriptional regulatory protein PhoB (SphR)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (228 amino acids)

>MPMX26_02625 Transcriptional regulatory protein BaeR (Acinetobacter radioresistens SK82)
MKHVMLVEDEVELAGLVRDYLEAGGFEVSVFHDGQEAYDHFLQRKPSLMILDLMVPRMDG
LTICRKVREQSDIPIIMVTARTEEIDRVLGLNMGADDYICKPFSPKELVARVQAVLRRLD
RKAEPEQNSLFRIDKAQQRIWYQQKSLNLTPTEFRLLELFLEHVGQVYSRAQLLDHINPD
SFDVADRVIDSHIKNLRRKITDAANTGNRHEWIQAVYGVGYRFEYPDE