Protein Info for MPMX26_02612 in Acinetobacter radioresistens SK82

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 443 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 41 to 62 (22 residues), see Phobius details amino acids 82 to 103 (22 residues), see Phobius details amino acids 114 to 156 (43 residues), see Phobius details amino acids 161 to 181 (21 residues), see Phobius details amino acids 202 to 221 (20 residues), see Phobius details amino acids 233 to 249 (17 residues), see Phobius details amino acids 254 to 272 (19 residues), see Phobius details amino acids 284 to 308 (25 residues), see Phobius details amino acids 339 to 361 (23 residues), see Phobius details amino acids 381 to 405 (25 residues), see Phobius details amino acids 416 to 437 (22 residues), see Phobius details PF03553: Na_H_antiporter" amino acids 83 to 221 (139 residues), 34.6 bits, see alignment E=6.5e-13 amino acids 241 to 434 (194 residues), 31.9 bits, see alignment E=4.3e-12

Best Hits

KEGG orthology group: None (inferred from 60% identity to abo:ABO_2705)

Predicted SEED Role

"Methionine transporter MetT" in subsystem Methionine Biosynthesis or Methionine Degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (443 amino acids)

>MPMX26_02612 hypothetical protein (Acinetobacter radioresistens SK82)
MTSDLSSKVQARVLALLPLIVFLAIFLGSGIYHSIIGTEFAFYQVKAPVAALPAIILALL
IYRGQINEAIEEFLKGASHPNLILMFMVFMFAGAFASVSSTIGSVDATVQLGLSIIPPSF
VLPMLFIISAFIATAMGTSMGTIAACAPIAFGFAQVTDIEVVYAIGAVVGGAMFGDNLSM
ISDTTIAATRSQNVELRDKFRVNVWIAVPASVITLIIYILTTHDSQTIEHTSYNLWLILP
YLAVFMLAFSRLHVLVTLGTGILLSGLIGLFVQPEFNLLKLNTAIYNGFVGMFEVALLSM
FLGGLSAIMQKEGGLQWLIERIYSVTRLFRVSRERAGELGVSFLVVFSNLFVANNTVAII
LSGDMAREVSKEYGLDPKRVAALMDIFSCVVQGLIPYGAQLLLACSIAKLSPVELLGHIY
YCWVLAIFAILSILFHYPRLKTV